beta-Endorphin - Cat #:MV1003
| polyclonal antibody to human beta-Endorphin conjugated to BSA |
 Immunohistochemical detection of beta-Endorphin in rat ventral lateral periaqueductal grey matter (PAG). Brain was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to beta-Endorphin at 10 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200. Tissue was counterstained with DAPI (blue color) to visualize cell nuclei. |
| Formulation |
Lyophilized from 10 mM PBS. |
| Purification |
Whole IgG |
| Host Species |
Rabbit |
| Unit Size: |
50 µg |
| Immunogen |
Human beta endorphin conjugated to BSA. |
| Sequence: |
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
| Antigen Location (aa): |
1-31 |
| Alternative Names |
N/A |
| Accession Number: |
P01189 |
| Accession Name: |
COLI_HUMAN |
| Accession URL: |
http://www.uniprot.org/uniprot/P01189 |
| Function: |
beta Endorphin is an endogenous opioid peptide that interacts with mu-opioid receptors a, like morphine, produces analgesic effects. |
| Applications: |
Recommended for Immunohistochemistry (IHC), Cytochemistry (ICC) and RIA. |
| Working Dilution for Immunofluorescence (ICC): |
5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): |
5 – 10 µg/mL |
| IHC Positive control: |
Brain (PAG) |
| Specificity: |
Confirmed by RIA against the synthetic peptide. |
| Cross-reactivity: |
Human; mouse; rat. Beta-endorphin is a highly conserved molecule, so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%. |
| Reconstitution: |
Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: |
At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References:
- Bloom F, Battenberg E, Rossier J, Ling N and Guillemin R. (1978) Proceedings of the National Academy of Sciences of the United States of America 75, 1591-5. PMID: 349568.
- Khachaturian H, Lewis ME, Haber SN, Akil H and Watson SJ. (1984) Brain Research Bulletin 13, 785-800. PMID: 6099745.
- Lamberts R and Goldsmith PC. (1986) Journal of Histochemistry & Cytochemistry 34, 389-98. PMID: 2419392.
- de Oliveira MS, da Silva Fernandes MJ, Scorza FA, et al., Brain Res Bull. 2010 Oct 30;83(5):278-83. PMID: 20655988.
- Stagg NJ, Mata HP, Ibrahim MM, et al., Anesthesiology. 2011 Apr;114(4):940-8. 21386701.
|
