MVS Pacific logo

Antibodies


 

beta-Endorphin - Cat #:MV1003
polyclonal antibody to human beta-Endorphin conjugated to BSA
beta-EndorphinImmunohistochemical detection of beta-Endorphin in rat ventral lateral periaqueductal grey matter (PAG). Brain was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to beta-Endorphin at 10 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200. Tissue was counterstained with DAPI (blue color) to visualize cell nuclei.
Formulation Lyophilized from 10 mM PBS.
Purification Whole IgG
Host Species Rabbit
Unit Size: 50 µg
Immunogen Human beta endorphin conjugated to BSA.
Sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Antigen Location (aa): 1-31
Alternative Names N/A
Accession Number: P01189
Accession Name: COLI_HUMAN
Accession URL: http://www.uniprot.org/uniprot/P01189
Function: beta Endorphin is an endogenous opioid peptide that interacts with mu-opioid receptors a, like morphine, produces analgesic effects.
Applications: Recommended for Immunohistochemistry (IHC), Cytochemistry (ICC) and RIA.
Working Dilution for Immunofluorescence (ICC): 5 – 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
IHC Positive control: Brain (PAG)
Specificity: Confirmed by RIA against the synthetic peptide.
Cross-reactivity: Human; mouse; rat. Beta-endorphin is a highly conserved molecule, so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%.
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References:
  1. Bloom F, Battenberg E, Rossier J, Ling N and Guillemin R. (1978) Proceedings of the National Academy of Sciences of the United States of America 75, 1591-5. PMID: 349568.
  2. Khachaturian H, Lewis ME, Haber SN, Akil H and Watson SJ. (1984) Brain Research Bulletin 13, 785-800. PMID: 6099745.
  3. Lamberts R and Goldsmith PC. (1986) Journal of Histochemistry & Cytochemistry 34, 389-98. PMID: 2419392.
  4. de Oliveira MS, da Silva Fernandes MJ, Scorza FA, et al., Brain Res Bull. 2010 Oct 30;83(5):278-83. PMID: 20655988.
  5. Stagg NJ, Mata HP, Ibrahim MM, et al., Anesthesiology. 2011 Apr;114(4):940-8. 21386701.

©2011 MVS Pacific, LLC All rights reserved