MVS Pacific logo

Antibodies


 

Tyrosine Hydroxylase (TH) - Cat #: AA116
Rabbit polyclonal antibody to Tyrosine Hydroxylase (TH)
Tyrosine Hydroxylase (TH) IHC image in rat brainImmunohistochemical detection of Tyrosine Hydroxylase in rat brain Substantia Nigra. Brain was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to Tyrosine Hydroxylase at 2 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200.
Neuronal nuclei were counterstained with DAPI (blue)
Tyrosine Hydroxylase (TH) Western Blot image
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 50 µg
Immunogen Synthetic peptide
Sequence: MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQSPRFIGRRQSLIEDAR
Alternative Names Tyrosine 3-hydroxylase
Accession Number: P07101
Gene Symbol TH
Accession URL: http://www.uniprot.org/uniprot/P07101
Function:
Plays a key role in the physiology of adrenergic neurons. TH catalyzes the conversion of the amino acid L-tyrosine to dihydroxyphenylalanine (DOPA), which, in turn, serves as a precursor for neurotransmiters dopamine, norepinephrine (noradrenaline) and epinephrine (adrenaline) the conversion of tyrosine to dopamine.
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 1– 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 1– 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: Brain, spinal cord, neuroendocrine cells
Specificity: Confirmed by WB.
Cross-reactivity: Human; mouse; rat
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Masserano JM, Weiner N (1983). Mol. Cell. Biochem. 53-54 (1-2): 129–52. PMID: 6137760.
  2. Meloni R, Biguet NF, Mallet J (2002). Mol. Neurobiol. 26 (2-3): 389–403. PMID: 12428766.
  3. Hosp JA, Pekanovic A, Rioult-Pedotti MS, Luft AR. J Neurosci. 2011 Feb 16;31(7):2481-7. PMID: 21325515.
  4. Simmons DA, Yahr P. J Chem Neuroanat. 2011 Jan;41(1):13-9. Epub 2010 Nov 16. PMID: 21087661.

©2011 MVS Pacific, LLC All rights reserved