MVS Pacific logo

Antibodies


 

Transforming growth factor beta-1 (TGF beta 1) - Cat #: AA125
Rabbit polyclonal antibody to TGF beta 1
TGF beta-1 IHC image in mouseImmunohistochemical detection of TGF beta 1 in distal convoluted tubules in mouse kidney cortex. Tissue was fixed with 4% formaldehyde and cut into 12 μm thick cryostat sections. Tissue sections were incubated with rabbit polyclonal antibody to TGF beta 1 at 8 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200 dilution. Nuclei were counterstained with DAPI (blue). TGF beta-1 Western Blot image
Immunohistochemical detection of TGF beta 1 in formalin fixed human prostate. 5 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to MMP2 at 8 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). Function:
TGF beta 1 (TGFB1) is a protein performing many fiunctions including control of proliferation and differentiation, and regulates the actions of many other growth factors. It is a potent stimulator of osteoblastic bone formation. Inactive TGFB1 is a homodimer consisting of a TGFB1 which is non-covalently linked to a latency-associated peptide (LAP), and the active form of TGFB1 is a homodimer of mature TGFB1 protein.
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 50 µg
Immunogen Synthetic peptide
Sequence: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
Alternative Names N/A
Accession Number: P04202
Gene Symbol TGFB1
Accession URL: http://www.uniprot.org/uniprot/P04202
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 5 – 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: Kidney (epithelial cells in convoluted tubules); stromal and epithelial cells in prostate.
Specificity: Confirmed by WB.
Reactivity: mouse, human
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Gutcher I, Donkor MK, Ma Q, Rudensky AY, Flavell RA, Li MO. Immunity. 2011 Mar 25;34(3):396-408. PMID: 21435587.
  2. Valkov A, Sorbye SW, Kilvaer TK, Donnem T, Smeland E, Bremnes RM, Busund LT. PLoS One. 2011 Mar 3;6(3):e17507. PMID: 21390241.
  3. Zanetti D, Poli G, Vizio B, Zingaro B, Chiarpotto E, Biasi F. Mol Aspects Med. 2003 Aug-Oct;24(4-5):273-80. PMID: 12893005.
  4. Ylä-Outinen H, Aaltonen V, Björkstrand AS, Hirvonen O, Lakkakorpi J, Vähä-Kreula M et al., J Invest Dermatol. 1998 Mar;110(3):232-7. PMID: 9506441.

©2011 MVS Pacific, LLC All rights reserved