MVS Pacific logo

Antibodies


 

Synaptophysin (SYP) - Cat #: AA115
Rabbit polyclonal antibody to Synaptophysin
Synaptophysin IHC image in rat brainImmunohistochemical detection of Synaptophysin in rat cerebellum. Tissue was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to Synaptophysin at 5 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200.

Nuclei of keratinocytes were counterstained with DAPI (blue)
Synaptophysin Western Blot image
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 50 µg
Immunogen Synthetic peptide
Sequence: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
Alternative Names Major synaptic vesicle protein p38.
Accession Number: P08247
Gene Symbol SYP
Accession URL: http://www.uniprot.org/uniprot/P08247
Function:
Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 5 – 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: Brain, spinal cord, neuroendocrine cells
Specificity: Confirmed by WB.
Cross-reactivity: Human; mouse; rat
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Kalina M, Lukinius A, Grimelius L, et al. (1991). Ultrastructural pathology 15 (3): 215–9. PMID: 1908157.
  2. Zhang PJ, Rosenblum MK (1997). Am. J. Surg. Pathol. 20 (3): 273–6 .PMID: 8772779.
  3. Maggiano N, Lauriola L, Serra FG, et al. (1999). J. Histochem. Cytochem. 47 (2): 237–43. PMID: 9889259
  4. Cassiman D, van Pelt J, De Vos R, et al. (1999). Am. J. Pathol. 155 (6): 1831–9. PMID: 10595912.
  5. Roudenok V, Kühnel W (2001). Ann. Anat. 183 (4): 345–51. PMID: 11508360.
  6. Yao I, Iida J, Nishimura W, Hata Y (2002). J. Neurosci. 22 (13): 5354–64. PMID: 12097487.

©2011 MVS Pacific, LLC All rights reserved