MVS Pacific logo

Antibodies


 

SMAD-2 (Cat #: AA114)
Rabbit polyclonal antibody to SMAD-2
SMAD-2 IHC image in skinImmunohistochemical detection of SMAD-2 in mouse skin. Tissue was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to SMAD-2 at 12 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200.

Nuclei of keratinocytes were counterstained with DAPI (blue)
SMAD-2 Western Blot image
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 50 µg
Immunogen Synthetic peptide
Sequence: MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVK
Alternative Names JV18-1, Mad-related protein 2.
Accession Number: Q15796
Gene Symbol SMAD2
Accession URL: http://www.uniprot.org/uniprot/Q15796
Function:
SMAD2 belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. SMAD2 mediates effects of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. SMAD2 is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, SMAD2 is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors.
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 5 – 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: Skin, Jurkat cell line.
Specificity: Confirmed by WB.
Cross-reactivity: Human; mouse; rat
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Riggins GJ, Thiagalingam S, Rozenblum E,et al., Nat Genet. 1996 Jul;13(3):347-9. PMID: 8673135.
  2. Baker JC, Harland RM. Genes Dev. 1996 Aug 1;10(15):1880-9. PMID: 8756346.
  3. Gittenberger-de Groot AC, Azhar M, Molin DG. Trends Cardiovasc Med. 2006 Jan;16(1):1-6. Review. PMID: 16387623.
  4. Brown KA, Pietenpol JA, Moses HL. J Cell Biochem. 2007 May 1;101(1):9-33. Review. PMID: 17340614.
  5. Wehrhan F, Nkenke E, Melnychenko I, et al., Dermatol Surg. 2010 Jun;36(6):919-30. PMID: 20618373.

©2011 MVS Pacific, LLC All rights reserved