MVS Pacific logo

Antibodies


 

Netrin-4 (NTN4) - Cat #: AA113
Rabbit polyclonal antibody to Netrin-4
Netrin-4 IHC image in rat brainImmunohistochemical detection of Netrin-4 in rat brain. Rat brain was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to Netrin-4 at 8 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200. Cell nuclei were counterstained with DAPI (blue) Netrin-4 Western Blot image
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 50 µg
Immunogen Synthetic peptide
Sequence: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
Alternative Names Beta-netrin, Hepar-derived netrin-like protein.
Accession Number: Q9HB63
Gene Symbol NTN4
Accession URL: http://www.uniprot.org/uniprot/Q9HB63
Function:
NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants. NTN4 belongs to a family of proteins related to laminins. NTN4 gene is overexpressed in breast carcinomas.
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 5 – 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: Brain, breast cancer tissues, MCF7 breast cancer cell line.
Specificity: Confirmed by WB.
Cross-reactivity: Human; mouse; rat
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Zhang C, Meng F, Wang C, Guo H, Fan M, Liu S, Zhou R, He F. Brain Res Mol Brain Res. 2004 Nov 4;130(1-2):68-80. PMID: 15519678.
  2. Esseghir S, Kennedy A, Seedhar P, et al., Clin Cancer Res. 2007 Jun 1;13(11):3164-73. PMID: 17545519.
  3. Larrieu-Lahargue F, Welm AL, Thomas KR, Li DY. Blood. 2010 Jul 1;115(26):5418-26. Epub 2010 Apr 20. PMID: 20407033.
  4. Yuan Y, Leszczynska M, Konstantinovsky S, Tropé CG, Reich R, Davidson B. Diagn Cytopathol. 2010 Aug 20. PMID: 20730893.

©2011 MVS Pacific, LLC All rights reserved