MVS Pacific logo

Antibodies


 

MMP9 (Cat #: AA124)
Rabbit polyclonal antibody to MMP9
MMP9 IHC image in prostate cancerImmunohistochemical detection of MMP9 in formalin fixed human prostate cancer. 15 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to MMP9 at 10 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). MMP9 Western Blot image
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 100 µg
Immunogen Synthetic peptide
Sequence: VAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTR
Alternative Names 92 kDa gelatinase, 92 kDa type IV collagenase, Gelatinase B
Accession Number: P14780
Gene Symbol MMP9
Accession URL: http://www.uniprot.org/uniprot/P14780
Function:
MMP9 degrades type IV and V collagens and is involved inproteolysis of the extracellular matrix. Produced by granulocytes and macrophages. MMP9 is involved with tissue destruction in a cancer invasion and metastasis, rheumatoid arthiritis, fibrotic lung disease and cardiomyopathy.
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 5 – 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: embryos, tumors of different origin
Specificity: Confirmed by WB.
Reactivity: Human, Mouse, Rat
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Tandon A, Sinha S. Bioinformation. 2011 Jan 22;5(8):310-4. PMID: 21383916.
  2. Park KS, Kim SJ, Kim KH, Kim JC. J Gastroenterol Hepatol. 2011 Feb;26(2):391-7. PMID: 21261731.
  3. Ram M, Sherer Y, Shoenfeld Y. J. Clin. Immunol. 2006, 26 (4): 299–307. PMID: 16652230.
  4. Bischof P, Meisser A, Campana A . Reprod. Immunol. 2002, 55 (1-2): pp3–10. PMID: 12062817.

©2011 MVS Pacific, LLC All rights reserved