MMP2 (Cat #: AA123)
| Rabbit polyclonal antibody to MMP2 |
 Immunohistochemical detection of MMP2 in formalin fixed human prostate cancer. 10 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to MMP2 at 6 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). |
Function: Metalloproteinase 2 is a 72kDa enzyme involved in remodeling of the vasculature, invasion of tumors and degrading extracellular matrix proteins. Its C-terminal does not have a catalytic function and have anti-tumor activity. Cane be detected extracellularly, in cytoplasm and cell nuclei. MMP2 is present in many tumors including breast and prostate cancer.
|
| Formulation |
Lyophilized powder |
| Purification |
Affinity purified |
| Host Species |
Rabbit |
| Unit Size: |
100 µg |
| Immunogen |
Synthetic peptide |
| Sequence: |
AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL |
| Alternative Names |
72 kDa gelatinase, Gelatinase A |
| Accession Number: |
P08253 |
| Gene Symbol |
MMP2 |
| Accession URL: |
http://www.uniprot.org/uniprot/P08253 |
| Applications: |
Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): |
5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): |
5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): |
1 µg/mL |
| IHC Positive control: |
Tumors of different origin |
| Specificity: |
Confirmed by WB. |
| Reactivity: |
Human |
| Reconstitution: |
Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: |
At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
- Qian Q, Wang Q, Zhan P, Peng L, Wei SZ, Shi Y, Song Y. Cancer Invest. 2010 Jul;28(6):661-9. Review. PMID: 20394501.
- Sounni NE, Janssen M, Foidart JM, Noel A. Matrix Biol. 2003 Mar;22(1):55-61. Review. PMID: 12714042.
- Fillmore HL, VanMeter TE, Broaddus WC. J Neurooncol. 2001 Jun;53(2):187-202. Review. PMID: 11716070.
- Bramhall SR, Neoptolemos JP, Stamp GW, Lemoine NR. J Pathol. 1997 Jul;182(3):347-55. PMID: 9349239.
|
