KDR (Cat #: AA121)
| Rabbit polyclonal antibody to KDR |
 Immunohistochemical detection of KDR in blood vessels endothelial cells in formalin fixed human placenta. 8 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to KDR at 8 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). |
 |
| Formulation |
Lyophilized powder |
| Purification |
Affinity purified |
| Host Species |
Rabbit |
| Unit Size: |
50 µg |
| Immunogen |
Synthetic peptide |
| Sequence: |
LNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSD |
| Alternative Names |
Fetal liver kinase 1 (FLK-1), Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1, CD309 |
| Accession Number: |
P35968 |
| Gene Symbol |
KDR |
| Accession URL: |
http://www.uniprot.org/uniprot/P35968 |
Function: KDR is the receptor for VEGF or VEGFC. It has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
|
| Applications: |
Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): |
5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): |
5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): |
1 µg/mL |
| IHC Positive control: |
Endothelial cells in vasculature |
| Specificity: |
Confirmed by WB. |
| Reactivity: |
Human |
| Reconstitution: |
Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: |
At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
- Färkkilä A, Anttonen M, Pociuviene J, Leminen A, Butzow R, Heikinheimo M, Unkila-Kallio L. Eur J Endocrinol. 2011 Jan;164(1):115-22. PMID: 21041381.
- Bellon A, Luchino J, Haigh K, Rougon G, Haigh J, Chauvet S, Mann F. Neuron. 2010 Apr 29;66(2):205-19. PMID: 20434998.
- Foroni L, Dirani G, Gualandi C, Focarete ML, Pasquinelli G. Tissue Eng Part C Methods. 2010 Aug;16(4):751-60. PMID: 19824801.
- Jørgensen JM, Sørensen FB, Bendix K, Nielsen JL, Funder A, Karkkainen MJ, et al.,. Leuk Lymphoma. 2009 Oct;50(10):1647-60. PMID: 19701853.
|
