MVS Pacific logo

Antibodies


 

KDR (Cat #: AA121)
Rabbit polyclonal antibody to KDR
KDR IHC image in placentaImmunohistochemical detection of KDR in blood vessels endothelial cells in formalin fixed human placenta. 8 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to KDR at 8 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). KDR Western Blot image
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 50 µg
Immunogen Synthetic peptide
Sequence: LNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSD
Alternative Names Fetal liver kinase 1 (FLK-1), Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1, CD309
Accession Number: P35968
Gene Symbol KDR
Accession URL: http://www.uniprot.org/uniprot/P35968
Function: KDR is the receptor for VEGF or VEGFC. It has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 5 – 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: Endothelial cells in vasculature
Specificity: Confirmed by WB.
Reactivity: Human
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Färkkilä A, Anttonen M, Pociuviene J, Leminen A, Butzow R, Heikinheimo M, Unkila-Kallio L. Eur J Endocrinol. 2011 Jan;164(1):115-22. PMID: 21041381.
  2. Bellon A, Luchino J, Haigh K, Rougon G, Haigh J, Chauvet S, Mann F. Neuron. 2010 Apr 29;66(2):205-19. PMID: 20434998.
  3. Foroni L, Dirani G, Gualandi C, Focarete ML, Pasquinelli G. Tissue Eng Part C Methods. 2010 Aug;16(4):751-60. PMID: 19824801.
  4. Jørgensen JM, Sørensen FB, Bendix K, Nielsen JL, Funder A, Karkkainen MJ, et al.,. Leuk Lymphoma. 2009 Oct;50(10):1647-60. PMID: 19701853.

©2011 MVS Pacific, LLC All rights reserved