MVS Pacific logo

Antibodies


 

IGF1R (Cat #: AA120)
Rabbit polyclonal antibody to IGF1R ((insulin-like growth factor 1 receptor)
IGF1R IHC image in isletsImmunohistochemical detection of IGF1R in islet in mouse pancreas. Tissue was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to IGF1R at 10 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit FITC conjugated secondary antibodies at 1:200 dilution. IGF 1R Western Blot image
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 50 µg
Immunogen Synthetic peptide
Sequence: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Alternative Names CD221
Accession Number: P08069
Gene Symbol IGF1R
Accession URL: http://www.uniprot.org/uniprot/P08069
Function:
IGF1R binds insulin-like growth factor 1 (IGF1) insulin-like growth factor 1 (IGF2).IGF1R is a tetramer composed of 2 alpha and 2 beta chains linked by disulfide bonds. The alpha chains is involved with the formation of the ligand-binding domain, and the beta chain carries the kinase domain.At a protein level is expressed in many tissues including muscle, heart, kidney, adipose tissue, skeletal muscle, fibroblasts, spleen and placenta. IGF1R is overexpressed in malignant tissues where it plays an anti-apoptotic function.
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 5 – 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: Kidney (epithelial cells in convoluted tubules); pancreas (islet cells).
Specificity: Confirmed by WB.
Reactivity: mouse
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Isard O, Knol AC, Ariès MF, Nguyen JM, Khammari A, Castex-Rizzi N, Dréno B. J Invest Dermatol. 2011 Jan;131(1):59-66. PMID: 20927124.
  2. Byles V, Chmilewski LK, Wang J, Zhu L, Forman LW, Faller DV, Dai Y. Int J Biol Sci. 2010 Oct 7;6(6):599-612. PMID: 20941378.
  3. An Y, Cai Y, Guan Y, Cai L, Yang Y, Feng X, Zheng J. Cancer Biother Radiopharm. 2010 Oct;25(5):545-52. PMID: 20950153.
  4. Hörndler C, Gallego R, García-Albeniz X, Alonso-Espinaco V, Alonso V, Escudero P, et al., J. Cancer Biol Ther. 2011 Jan 15;11(2):177-83. PMID: 21099348.

©2011 MVS Pacific, LLC All rights reserved