MVS Pacific logo

Antibodies


 

Caspase 3 (N-terminal; (Cat #: AA118)
Rabbit polyclonal antibody to N-terminal region of Caspase 3
Caspase-3 IHC imageImmunohistochemical detection of Caspase 3 in apoptosis induced Jurkat cells. Cells were fixed with 1% formaldehyde incubated with rabbit polyclonal antibody to N-terminal region of Caspase 3 at 6 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200 dilution. Nuclei were counterstained with DAPI (blue). Caspase-3 N-term Western Blot image
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 100 µg
Immunogen Synthetic peptide
Sequence: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII
Alternative Names Apopain, Cysteine protease CPP32 (CPP-32), protein Yama, SREBP cleavage activity 1 (SCA-1)
Accession Number: P42574
Gene Symbol CASP3
Accession URL: http://www.uniprot.org/uniprot/P42574
Function:
Caspase 3 is a heterotetramer of two heterodimers arranged in anti-parallel orientation. Casapse 3 activates caspases 6 and 7 and this sequential activation leads to apoptosis. CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Caspase 3 participates in cleavage of Amyloid beta 4A precursor protein which is implicated with neuronal death Alzheimer's disease. Caspase 3 in turn is processed by caspases 8, 9 and 10.
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 2– 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: Cells (HeLA, Jurkat) treated with agents that induce apoptosis such as antibiotic AM-2282 or staurosporin (STS). Spleen, kidney and heart.
Specificity: Confirmed by WB.
Reactivity: Human
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Tsuda Y, Kanje M, Dahlin LB. BMC Neurosci. 2011 Jan 21;12:12. PMID: 21251262 (free text article).
  2. Bressenot A, Marchal S, Bezdetnaya L, Garrier J, Guillemin F, Plénat F. J Histochem Cytochem. 2009 Apr;57(4):289-300. PMID: 19029405 (free text article).
  3. Duan WR, Garner DS, Williams SD, Funckes-Shippy CL, Spath IS, Blomme EA. J Pathol. 2003 Feb;199(2):221-8. PMID: 12533835.
  4. Li M, Ona VO, Guégan C, Chen M, Jackson-Lewis V, Andrews LJ, Olszewski AJ, Science. 2000 Apr 14;288(5464):335-9. PMID: 10764647.
  5. Buckley CD, Pilling D, Henriquez NV, Parsonage G, Threlfall K, Scheel-Toellner D, et al., Nature. 1999 Feb 11;397(6719):534)-9. PMID: 10028971.
  6. Kim TW, Pettingell WH, Jung YK, Kovacs DM, Tanzi RE. Science. 1997 Jul 18;277(5324):373-6. PMID: 9219695 (free text article).

©2011 MVS Pacific, LLC All rights reserved