CSF1 (Cat #: AA127)
| Rabbit polyclonal antibody to CSF1 |
 Immunohistochemical detection of CSF1 in formalin fixed human placenta. 12 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to CSF1 at 10 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). |
 |
| Formulation |
Lyophilized powder |
| Purification |
Affinity purified |
| Host Species |
Rabbit |
| Unit Size: |
50 µg |
| Immunogen |
Synthetic peptide |
| Sequence: |
MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP |
| Alternative Names |
Lanimostim, Macrophage Colony-Stimulating Factor 1 |
| Accession Number: |
P09603 |
| Gene Symbol |
CSF1 |
| Accession URL: |
http://www.uniprot.org/uniprot/P09603 |
Function: CSF1 is a cytokine that controls the production, differentiation, and function of monocytes/macrophages. CSF1 increases susceptibility of macrophages to viral infection, and enhances HIV)replication in infected macrophages. Nuclear NFAT can activate CSF-1 gene transcription by connecting with the CSF-1 promoter in the signaling events induced by L-selectin ligation.
|
| Applications: |
Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): |
2 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): |
1 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): |
1 µg/mL |
| IHC Positive control: |
stromal cell in placenta |
| Specificity: |
Confirmed by WB. |
| Reactivity: |
Human |
| Reconstitution: |
Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: |
At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
- Sharma M, Beck AH, Webster JA, Espinosa I, Montgomery K, Varma S, et al., Breast Cancer Res Treat. 2010 Sep;123(2):397-404. PMID: 19949854.
- Arcuri F, Buchwalder L, Toti P, Cintorino M, Tosi P, Lockwood CJ, Rybalov B, Schatz F. Biol Reprod. 2007 Mar;76(3):433-9. PMID: 17108334 (free article).
- Yang M, Mailhot G, MacKay CA, Mason-Savas A, Aubin J, Odgren PR. Blood. 2006 Mar 15;107(6):2262-70. PMID: 16304045 (free article).
- Kruger M, Van de Winkel JG, De Wit TP, Coorevits L, Ceuppens JL. Immunology. 1996 Sep;89(1):89-95. PMID: 8911145 (free article).
|
