| Product Description | polyclonal antibody to human beta-Endorphin conjugated to BSA |
![]() Immunohistochemical detection of beta-Endorphin in rat ventral lateral periaqueductal grey matter (PAG). Brain was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to beta-Endorphin at 10 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200. Tissue was counterstained with DAPI (blue color) to visualize cell nuclei. | |
| Formulation | Lyophilized from 10 mM PBS. |
| Purification | Whole IgG |
| Host Species | Rabbit |
| Unit Size: | 50 µg |
| Immunogen | Human beta endorphin conjugated to BSA. |
| Sequence: | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
| Antigen Location (aa): | 1-31 |
| Alternative Names | N/A |
| Accession Number: | P01189 |
| Accession Name: | COLI_HUMAN |
| Accession URL: | http://www.uniprot.org/uniprot/P01189 |
| Function: | beta Endorphin is an endogenous opioid peptide that interacts with mu-opioid receptors a, like morphine, produces analgesic effects. |
| Applications: | Recommended for Immunohistochemistry (IHC), Cytochemistry (ICC) and RIA. |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
| IHC Positive control: | Brain (PAG) |
| Specificity: | Confirmed by RIA against the synthetic peptide. |
| Cross-reactivity: | Human; mouse; rat. Beta-endorphin is a highly conserved molecule, so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%. |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References:
| |

