logo
TNFRSF1 (tumor necrosis factor receptor superfamily, member 1A) - Cat #: AA126
Rabbit polyclonal antibody to TNFRSF1
TNFRSF1A IHCImmunohistochemical detection of TNFRSF1A in human monocytes. Cells were fixed with 1% formaldehyde incubated with rabbit polyclonal antibody to TNFRSF1A at 5 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200 dilution. Nuclei were counterstained with DAPI (blue).TNFRSF1A WB
FormulationLyophilized powder
PurificationAffinity purified
Host SpeciesRabbit
Unit Size:50 µg
ImmunogenSynthetic peptide
Sequence:MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI
Alternative NamesTumor necrosis factor receptor 1 (TNF-R1), Tumor necrosis factor receptor type I (TNF-RI, TNFR-I), p55, p60, CD120a
Accession Number:P19438
Gene SymbolTNFRSF1A
Accession URL:http://www.uniprot.org/uniprot/P19438
Function:
TNFRSF1A is the receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor and the resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. TNFRSF1A contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor.
Applications:Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC):2– 15 µg/mL
Working Dilution for Immunohistochemistry (IHC):5 – 10 µg/mL
Working Dilution for Western Blottin (WB):1 µg/mL
IHC Positive control:Monocytes
Specificity:Confirmed by WB.
Reactivity:Human
Reconstitution:Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability:At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Kümpfel T, Hohlfeld R. Nat Rev Neurol. 2009 Oct;5(10):528-9. PMID: 19794511.
  2. Lappalainen M, Halme L, Turunen U, Saavalainen P, Einarsdottir E, Färkkilä M, Kontula K, Paavola-Sakki P. Inflamm Bowel Dis. 2008 Aug;14(8):1118-24. PMID: 18338763 (free text article).
  3. Jesus AA, Oliveira JB, Aksentijevich I, Fujihira E, Carneiro-Sampaio MM, Duarte AJ, Silva CA. Eur J Pediatr. 2008 Dec;167(12):1421-5. PMID: 18408954.
  4. Galon J, Aksentijevich I, McDermott MF, O'Shea JJ, Kastner DL. Curr Opin Immunol. 2000 Aug;12(4):479-86. Review. PMID: 10899034.