| Rabbit polyclonal antibody to MMP1 | |
|---|---|
![]() Immunohistochemical detection of MMP1 in formalin fixed human ovarian carcinoma. 8 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to MMP1 at 8 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). | ![]() |
| Formulation | Lyophilized powder |
| Purification | Affinity purified |
| Host Species | Rabbit |
| Unit Size: | 100 µg |
| Immunogen | Synthetic peptide |
| Sequence: | PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF |
| Alternative Names | Fibroblast collagenase |
| Accession Number: | P03956 |
| Gene Symbol | MMP1 |
| Accession URL: | http://www.uniprot.org/uniprot/P03956 |
| Function: MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, III, VII and X. This enzyme is involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. | |
| Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): | 1 µg/mL |
| IHC Positive control: | embryos, tumors of different origin |
| Specificity: | Confirmed by WB. |
| Reactivity: | mouse |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
| |


