| Rabbit polyclonal antibody to KDR | |
|---|---|
 Immunohistochemical detection of KDR in blood vessels endothelial cells in formalin fixed human placenta. 8 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to KDR at 8 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). |  |
| Formulation | Lyophilized powder |
| Purification | Affinity purified |
| Host Species | Rabbit |
| Unit Size: | 50 µg |
| Immunogen | Synthetic peptide |
| Sequence: | LNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSD |
| Alternative Names | Fetal liver kinase 1 (FLK-1), Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1, CD309 |
| Accession Number: | P35968 |
| Gene Symbol | KDR |
| Accession URL: | http://www.uniprot.org/uniprot/P35968 |
| Function: KDR is the receptor for VEGF or VEGFC. It has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. | |
| Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): | 1 µg/mL |
| IHC Positive control: | Endothelial cells in vasculature |
| Specificity: | Confirmed by WB. |
| Reactivity: | Human |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
| |
