| Rabbit polyclonal antibody to IGF1R ((insulin-like growth factor 1 receptor) | |
|---|---|
 Immunohistochemical detection of IGF1R in islet in mouse pancreas. Tissue was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to IGF1R at 10 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit FITC conjugated secondary antibodies at 1:200 dilution. |  |
| Formulation | Lyophilized powder |
| Purification | Affinity purified |
| Host Species | Rabbit |
| Unit Size: | 50 µg |
| Immunogen | Synthetic peptide |
| Sequence: | DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC |
| Alternative Names | CD221 |
| Accession Number: | P08069 |
| Gene Symbol | IGF1R |
| Accession URL: | http://www.uniprot.org/uniprot/P08069 |
| Function: IGF1R binds insulin-like growth factor 1 (IGF1) insulin-like growth factor 1 (IGF2).IGF1R is a tetramer composed of 2 alpha and 2 beta chains linked by disulfide bonds. The alpha chains is involved with the formation of the ligand-binding domain, and the beta chain carries the kinase domain.At a protein level is expressed in many tissues including muscle, heart, kidney, adipose tissue, skeletal muscle, fibroblasts, spleen and placenta. IGF1R is overexpressed in malignant tissues where it plays an anti-apoptotic function. | |
| Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): | 1 µg/mL |
| IHC Positive control: | Kidney (epithelial cells in convoluted tubules); pancreas (islet cells). |
| Specificity: | Confirmed by WB. |
| Reactivity: | mouse |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
| |
