| Rabbit polyclonal antibody to BACE-1 | ||
|---|---|---|
![]() Immunohistochemical detection of BACE-1 in astrocytes in rat cortex. Rat brain was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to BACE-1 at 10 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200 dilution. Nuclei were counterstained with DAPI (blue) |
| |
![]() Immunohistochemical detection of BACE-1 in mouse cerebellum. Mouse brain was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to BACE-1 at 10 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200 dilution. Nuclei were counterstained with DAPI (blue) | ![]() Immunohistochemical detection of BACE1 in reactive astrocytes in formalin fixed Alzheimer's human brain.12 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to MMP1 at 8 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). | |
| Function: BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. BACE-1 is a member of the peptidase A1 protein family and is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. In brains of patients with Alzheimer's disease, BACE-1 is detected in reactive astrocytes, suggesting that astrocyte activation may play a role in the development of Alzheimer's disease. | ||
| Formulation | Lyophilized powder | |
| Purification | Affinity purified | |
| Host Species | Rabbit | |
| Unit Size: | 50 µg | |
| Immunogen | Synthetic peptide | |
| Sequence: | GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY | |
| Alternative Names | Aspartyl protease 2; Beta-site amyloid precursor protein cleaving enzyme 1; Memapsin-2; Membrane-associated aspartic protease 2 | |
| Accession Number: | P56817 | |
| Gene Symbol | BACE1 | |
| Accession URL: | http://www.uniprot.org/uniprot/P56817 | |
| Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). | |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL | |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL | |
| Working Dilution for Western Blottin (WB): | 1 µg/mL | |
| IHC Positive control: | Human brain (neurons and glial cells). | |
| Specificity: | Confirmed by WB. | |
| Cross-reactivity: | Human; mouse; rat | |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. | |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. | |
References
| ||




