Antibodies
| Rabbit polyclonal antibody to VMAT2 | |
|---|---|
 in human hippocampus.jpg) Immunohistochemical detection of VMAT2 in neurons in formalin fixed human brain cortex. 10 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to VMAT2 at 10 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). |
-ARP43845-QC17330-WB-image-01.gif) |
| Formulation | Lyophilized powder |
| Purification | Affinity purified |
| Host Species | Rabbit |
| Unit Size: | 50 µg |
| Immunogen | Synthetic peptide |
| Sequence: | NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT |
| Alternative Names | Solute carrier family 18 member 2, Vesicular amine transporter 2 (VAT2) |
| Accession Number: | Q05940 |
| Gene Symbol | SLC18A2,SVMT, VMAT2 |
| Accession URL: | http://www.uniprot.org/uniprot/Q05940 |
| Function: This is a cytoplasmic vesicle membrane multi-pass membrane protein which belongs to the vesicular transporter family. The vesicular monoamine transporter 2 is nvolved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters into synaptic vesicles: dopamine, norepinephrine, serotonin, and histamine. Provides vesicular amine storage prior to secretion via exocytosis.. |
|
| Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): | 1 µg/mL |
| IHC Positive control: | Human brain cortex. |
| Specificity: | Confirmed by WB. |
| Cross-reactivity: | Human, mouse, rat, bovine |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|
|