Antibodies
| Rabbit polyclonal antibody to TIMP2 (middle region) | |
|---|---|
Immunohistochemical detection of TIMP2 in formalin fixed human ovary. 8 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to TIMP2 at 10 μg/mL overnight at 4°C followed by HRP/DAB detection (brown) and counterstaining with hematoxylin (blue). |
![]() |
| Formulation | Lyophilized powder |
| Purification | Affinity purified |
| Host Species | Rabbit |
| Unit Size: | 50 µg |
| Immunogen | Synthetic peptide |
| Sequence: | IVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVT |
| Alternative Names | CSC-21K, Tissue inhibitor of metalloproteinases 2 |
| Accession Number: | P16035 |
| Gene Symbol | TIMP2 |
| Accession URL: | http://www.uniprot.org/uniprot/P16035 |
| Function: Interacts (via the C-terminal) with MMP2 (via the C-terminal PEX domain); the interaction inhibits the MMP2 activity. FOrms complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. |
|
| Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): | 1 µg/mL |
| IHC Positive control: | ovary, prostate, colon |
| Specificity: | Confirmed by WB. |
| Reactivity: | Human |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|
|

Immunohistochemical detection of TIMP2 in formalin fixed human ovary. 8 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to TIMP2 at 10 μg/mL overnight at 4°C followed by HRP/DAB detection (brown) and counterstaining with hematoxylin (blue). -ARP59181-QC30093-WB-image-01.gif)