Antibodies
| Rabbit polyclonal antibody to Complexin-2 | |
|---|---|
 Immunohistochemical detection of Complexin-2 in neuronal processes in formalin fixed human brain cortex. 10 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to Complexin-2 at 5 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). |
 |
| Formulation | Lyophilized powder |
| Purification | Affinity purified |
| Host Species | Rabbit |
| Unit Size: | 50 µg |
| Immunogen | Synthetic peptide |
| Sequence: | MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA |
| Alternative Names | Complexin II, CPX II, Synaphin-1 |
| Accession Number: | Q6PUV4 |
| Gene Symbol | CPLX2 |
| Accession URL: | http://www.uniprot.org/uniprot/Q6PUV4 |
| Function: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. Negatively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Positively regulates a late step in synaptic vesicle exocytosis. Also involved in mast cell exocytosis. Complexin-2 binds to the SNARE core complex containing SNAP25, VAMP2 and STX1A |
|
| Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): | 1 µg/mL |
| IHC Positive control: | Human brain cortex. |
| Specificity: | Confirmed by WB. |
| Cross-reactivity: | Human |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|
|